PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G426700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 269aa    MW: 28788.4 Da    PI: 9.3409
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G426700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-181762147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +g+W++eEd +l ++v+q+G+++W++I++ ++ gR++k+c++rw + 
  Sevir.3G426700.1.p 17 KGSWSPEEDAQLTRLVEQHGPHRWSLISAAIP-GRSGKSCRLRWCNQ 62
                        799*****************************.***********985 PP

2Myb_DNA-binding51.32.6e-1671113347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++T+ Ed +++ a++++G++ W+tIar ++ gRt++++k++w++ 
  Sevir.3G426700.1.p  71 AFTAHEDAIILGAHARYGNK-WATIARLLP-GRTDNSIKNHWNSN 113
                         79******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.2341267IPR017930Myb domain
SMARTSM007172.4E-171665IPR001005SANT/Myb domain
SuperFamilySSF466893.41E-3016110IPR009057Homeodomain-like
PfamPF002498.0E-181762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-251870IPR009057Homeodomain-like
CDDcd001677.55E-161961No hitNo description
PROSITE profilePS5129417.39168118IPR017930Myb domain
SMARTSM007176.9E-1368116IPR001005SANT/Myb domain
PfamPF002493.0E-1371113IPR001005SANT/Myb domain
CDDcd001674.20E-1171114No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2171116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MASDAPPPAT AVVVMKKGSW SPEEDAQLTR LVEQHGPHRW SLISAAIPGR SGKSCRLRWC  60
NQLSPEVQHR AFTAHEDAII LGAHARYGNK WATIARLLPG RTDNSIKNHW NSNLRRCRRR  120
AAALAAAGAP STSSRAAAAG GTQQLFLQQD MDSAPPVADQ QPASGLGLLN PNNHRDDDGA  180
LHEPSTSLSL TLGLPLPEPE AGASATGMKA ADQQPSPLPL RMPEEEGNAQ AQLMAVVRQM  240
VREEVQRQTG QLAYSLMAAA AWAKGHHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-39141161103C-Myb DNA-Binding Domain
1msf_C5e-39141161103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432281e-131AC243228.1 Panicum virgatum clone PV_ABa011-D10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002489094.11e-75hypothetical protein SORBIDRAFT_0088s002210
TrEMBLK3Z8T90.0K3Z8T9_SETIT; Uncharacterized protein
STRINGSi022959m1e-180(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135442731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.14e-52myb domain protein 73